![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS60227.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 71aa MW: 8726.06 Da PI: 11.7243 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 69.1 | 5.3e-22 | 4 | 63 | 3 | 57 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++t+eql+ Lee+++ r+psae+++++ +kl +++ ++V++WFqN++a+ek+ EPS60227.1 4 TRWSPTPEQLQSLEEMYRHgVRTPSAEQIQQIVAKLrrfgRIEGKNVFYWFQNHKAREKQ 63 8*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 116.2 | 1.5e-37 | 3 | 65 | 3 | 65 |
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 +tRW+PtpeQ++ Lee+y++G+rtP++e+iq+i a+L+++G+ie+kNVfyWFQN+kaRe+q++ EPS60227.1 3 STRWSPTPEQLQSLEEMYRHGVRTPSAEQIQQIVAKLRRFGRIEGKNVFYWFQNHKAREKQRK 65 79***********************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 11.224 | 1 | 64 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.1E-5 | 1 | 68 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.2E-19 | 4 | 63 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.1E-13 | 4 | 67 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.9E-10 | 4 | 63 | IPR009057 | Homeodomain-like |
PROSITE pattern | PS00616 | 0 | 13 | 27 | IPR033379 | Histidine acid phosphatase active site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
LMSTRWSPTP EQLQSLEEMY RHGVRTPSAE QIQQIVAKLR RFGRIEGKNV FYWFQNHKAR 60 EKQRKRRRLE L |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 63 | 67 | RKRRR |
2 | 64 | 68 | KRRRL |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012844100.1 | 2e-37 | PREDICTED: WUSCHEL-related homeobox 6-like | ||||
Swissprot | Q6X7K0 | 2e-33 | WOX1_ARATH; WUSCHEL-related homeobox 1 | ||||
TrEMBL | S8DL22 | 3e-46 | S8DL22_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | GLYMA05G33850.2 | 7e-33 | (Glycine max) | ||||
STRING | GLYMA08G05831.1 | 1e-33 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4681 | 23 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18010.1 | 2e-29 | WUSCHEL related homeobox 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|